Web Analysis for Fisdk12 Eduphoria - eduphoria.fisdk12.net
2.50
Rating by CuteStat
This website is a sub-domain of fisdk12.net. It has a global traffic rank of #92013 in the world. This website is estimated worth of $ 158,400.00 and have a daily income of around $ 220.00. As no active threats were reported recently by users, eduphoria.fisdk12.net is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | 18,296 |
Daily Pageviews: | 109,776 |
Estimated Valuation
Income Per Day: | $ 220.00 |
Estimated Worth: | $ 158,400.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 46 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 92,013 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 2 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
HTTP/1.1 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 02 Jan 2020 10:13:15 GMT
Content-Length: 13491
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 02 Jan 2020 10:13:15 GMT
Content-Length: 13491
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
eduphoria.fisdk12.net | A | 9331 |
IP: 72.20.155.155 |
Similarly Ranked Websites
TransIP | STACK - Jouw online cloud opslag
- stackstorage.com
STACK is online cloud opslag voor het gemakkelijk bewaren, synchroniseren en delen van al je bestanden
92,014
$
158,400.00
Forums - Miller Welding Discussion Forums
- forum.millerwelds.com
vBulletin Forums
92,014
$
158,400.00
Elite Marketing Pro | Welcome
- seanlynnwyman.elitemarketingpro.com
Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs
92,015
$
90,000.00